PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G024000.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 378aa    MW: 39834.1 Da    PI: 9.7434
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G024000.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like71.31.5e-2277130155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k rl+W+p+LH +Fv+a ++L G + A+P +il+ mk++g+t+++v+SHLQkYR 
  Seita.5G024000.3.p  77 KDRLVWSPKLHGKFVRACNEL-GVKDAVPMKILRRMKINGITRAQVASHLQKYRG 130
                         68*******************.999*****************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-2375134IPR009057Homeodomain-like
SuperFamilySSF466892.51E-1576133IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-1877129IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MADGGGNNGN GAASTETGTT TVVESHPPQQ AVTPKKPKKR KKSESSDEQS SGATVPGGCT  60
APDGDGGRDP KQEANKKDRL VWSPKLHGKF VRACNELGVK DAVPMKILRR MKINGITRAQ  120
VASHLQKYRG SLSKRKDEET SGNRGDATTV MVVHHTPLDA ASPSPPATAT APPPAIPPSV  180
PPSPQSPLET PDTMCQPPNG HSSDHAVAAA NLHHQQLQLL LLPPVQHQHC FPPPPLLHQV  240
GAVTITEEKT PSMMQQQAAV APASQHGPTL VGVEQAAGAP VPASAAENGP PVSMLRAFPK  300
ANMMRLEEPE TRMAQALVVA KDEKGQRRAA EPEAAGAASL SPPGSIIERY WGSGDRPSWD  360
LFGLRPRLAS CRRGFPR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13440KKPKKRK
23642PKKRKKS
33741KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967534.10.0PREDICTED: probable transcription factor GLK2 isoform X1
RefseqXP_012701194.10.0PREDICTED: probable transcription factor GLK2 isoform X1
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59570.11e-17G2-like family protein